The Journal of Biochemistry
Online ISSN : 1756-2651
Print ISSN : 0021-924X
Volume 101, Issue 6
Displaying 1-21 of 21 articles from this issue
  • Tatsushi MUTA, Toshiyuki MIYATA, Fuminori TOKUNAGA, Takanori NAKAMURA, ...
    1987Volume 101Issue 6 Pages 1321-1330
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    The complete amino acid sequence of anti-lipopolysaccharide (LPS) factor purified from the hemocytes lysate of the American horseshoe crab, Limulus polyphemus, was determined by characterization of the NH2-terminal sequence and the peptides generated after digestion of the protein with lysyl endopeptidase, clostripain, and Staphylococcus aureus V 8 protease. Upon sequencing the peptides by the automated Edman method, the following primary structure was obtained:
    DGIWTQLIFTLVNKNLATLWQSGDFQFLDHE_??_CHYRIKPTFRRLKWKYKGKFWCPSWTSITGRATKSSRSGAVEHSVRNFVGQAKSSGLITQRQAEQFISQYN
    During the sequence analysis, two species of the protein, which differed from each other at one locus, were found and characterized. L. polyphemus anti-LPS factor was a basic protein consisting of a single polypeptide chain of 101 residues and a calculated molecular weight of 11, 786 or 11, 800. The hydrophobic NH2-terminal sequence and the clustering of positive charges found in the disulfide loop yielded a typical amphipathic character of this protein. Moreover, L. polyphemus anti-LPS factor showed 83% sequence identity with the Tachypleus tridentatus protein, and the sequence similar to that observed in the EF-hand structure was found to contain in the COOH terminal portions of these proteins, although its function is unknown.
    Download PDF (704K)
  • Yoshihiro ANDO, Sadao IMAMURA, Yoko YAMAGATA, Takanobu KIKUCHI, Takash ...
    1987Volume 101Issue 6 Pages 1331-1337
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    A high-performance liquid chromatographic method was developed for the assay of transglutaminase [EC 2. 3. 2. 13] activity. Casein and dansylcadaverine were used as substrates and the reaction was stopped by adding an excess amount of EGTA. Casein-bound dansylcadaverine was separated from free dansylcadaverine by highperformance liquid chromatography on a TSK SW gel column on the basis of the differences in the molecular weight and hydrophobicity. The sensitivity was approximately 0.04 nmol of casein-bound dansylcadaverine in the assay mixture. With this assay method, human erythrocyte transglutaminase and platelet factor XIII were purified by successive chromatographies on DEAE-cellulose and Sephacryl S-300, which were common for both enzymes, followed by Blue Sepharose CL-6B and DEAE Bio-Gel A for erythrocyte transglutaminase or Phenyl-Sepharose CL-4B for platelet factor XIII. The purification factors and activity yields were 15, 300-fold and 22% for erythrocyte transglutaminase and 43.8-fold and 33% for platelet factor XIII.
    Download PDF (1443K)
  • Koscak MARUYAMA, Di Hua HU, Tsuneo SUZUKI, Sumiko KIMURA
    1987Volume 101Issue 6 Pages 1339-1346
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    The binding of actin filaments to connectin, a muscle elastic protein, was investigated by means of turbidity and sedimentation measurements and electron microscopy. In the presence of less than 0.12M KCl at pH 7.0, actin filaments bound to connectin. Long actin filaments formed bundles. Short actin filaments also aggregated into irregular bundles or a meshwork, and were frequently attached perpendicularly to long bundles. The binding of F-actin to connectin was saturated at an equal weight ratio (molar ratio, 50:1), as determined by a cosedimentation assay. Larger amounts of sonicated short actin filaments appeared to bind to connectin than intact F-actin. Myosin S1-decorated actin filaments did not bind to connectin. The addition of S 1 to connectin-induced actin bundles resulted in partial disaggregation. Thus, connectin does not appear to interfere with actinmyosin interactions, since myosin S 1 binds to actin more strongly than connectin.
    Download PDF (4019K)
  • Tohoru NAKAMURA, Masaki GOTO, Jiro KOYAMA
    1987Volume 101Issue 6 Pages 1347-1353
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    As previously reported, the membrane fraction of liquid paraffin-induced, guinea pig peritoneal macrophages exhibits an NADPH-dependent hemolytic activity toward sheep erythrocytes. This activity was inhibited with N-ethylmaleimide, superoxide dismutase, cytochrome c, catalase, desferrioxamine, mannitol, and benzoate. These inhibition profiles indicate that O2- generation by the NADPH oxidase, peroxidation of the membranous lipids with H2O2 or •OH secondarily formed from O2-, and hemolysis of sheep erythrocytes with the peroxides occur in this order in the hemolytic reaction. In fact, the lipid peroxides were found to be formed in the membrane fraction in the presence of Fe3+, subsequent to the O2- generation, and to act as a final hemolytic agent.
    Download PDF (621K)
  • Yasuko MIYAKE, Tohru FUNAHASHI, Akira YAMAMOTO
    1987Volume 101Issue 6 Pages 1355-1360
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Familial hypercholesterolemia (FH) is a congenital disorder of plasma low density lipoprotein (LDL) metabolism resulting from the defect or malfunction of LDL receptors on the cell surface. In most cases of FH, LDL binding to the cell surface is disrupted, while in some special cases LDL binding to the receptors occurs normally but the internalization of the bound LDL is inhibited (internalization-defective type). We studied the biosynthesis and transport of the LDL receptor in cultured fibroblasts obtained from one of the internalization-defective mutants by using [35S] methionine labeling and detection with anti-LDL receptor antibody. The mutant cells synthesized LDL receptors with a molecular weight slightly smaller than normal as shown in SDS-polyacrylamide gel electrophoresis. A large portion of the synthesized receptors was secreted into the medium while the other portion was associated with the cells. The apparent molecular weight of the receptors secreted into the medium was about 10 kDa smaller than that of the cell-associated receptors. The cell-associated form was converted into the secreted form following a prolonged incubation of the cells, showing the precursor-product relationship between the cell-associated and the secreted forms.
    Download PDF (2040K)
  • Tomofumi KUROKAWA, Saburo HARA, Hidenari TAKAHARA, Kiyoshi SUGAWARA, T ...
    1987Volume 101Issue 6 Pages 1361-1367
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    The deimination of the arginine residues in peanut trypsin-chymotrypsin inhibitor B-III caused the disappearance of its trypsin-inhibitory activity. Peanut protease inhibitor B-III was incubated with peptidylarginine deiminase, resulting in the conversion of 2.5 mol of arginine to citrulline and in the loss of its trypsin-inhibitory activity. However, the ability of the deiminated inhibitor to inhibit chymotrypsin was as strong as before. Structural analysis of the deiminated B-III indicated that the P1 arginine residues at both reactive sites, Arg (10) and Arg (38), were completely modified to citrulline by the action of peptidylarginine deiminase, and that the Arg (60) in the C-terminal region of B-III was partially deiminated. These residues seem to be exposed on the surface of the molecule. The P1' arginine residue at the first reactive site, Arg (11), was not deiminated at all.
    Download PDF (1027K)
  • Yukitoshi ISHIKAWA, Shinsei GASA, Ryoji MINAMI, Akira MAKITA
    1987Volume 101Issue 6 Pages 1369-1375
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Neutral glycosphingolipids were isolated from normal human fetal brains, at 22 to 23 weeks gestation. They were identified as monohexosylceramides, lactosylceramide, and glycolipids belonging to the globo (globotriaosylceramide) and ganglio (gangliotriaosylceramide) series. In addition, considerable amounts of neolactotetraosylceramide and III3-α-fucosyl-neolactotetraosylceramide were detected. Although neutral glycolipids of the globo, ganglio, and neolacto series have been demonstrated in the brains of cases with some sphingolipidoses, they are not present in appreciable amounts in differentiated normal brain. Therefore, the present and previous observations would imply that the metabolism of these glycolipid series actively occurs in the normal brain at an early stage of differentiation and continues thereafter in the brain in the case of some sphingolipidoses. The diseased brain is most probably accompanied by a disturbance of differentiation.
    Download PDF (1726K)
  • Kenji KIHIRA, Akira OKAMOTO, Takahiko HOSHITA
    1987Volume 101Issue 6 Pages 1377-1384
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Biliary bile acids of Alligator mississippiensis were analyzed by gas-liquid chromatography-mass spectrometry after fractionation by silica gel column chromatography. It was shown that the alligator bile contained 12 C27 bile acids and 8 C24 bile acids. In addition to the C27 bile acids, such as 3α, 7α, 12α-trihydroxy-5β-cholestanoic acid, 3α, 7α, 12α-trihydroxy-5α-cholestanoic acid, 3α, 7α-dihydroxy-5β-cholestanoic acid, 3α, 12α-dihydroxy-5β-cholestanoic acid, 7α, 12α-dihydroxy-3-oxo-5β-cholestanoic acid, and 3α, 12α-dihydroxy-7-oxo-5β-cholestanoic acid, identified previously in the bile of A. mississippiensis, 3α, 7β-dihydroxy-5β-cholestanoic acid, 3α, 7β, 12α-trihydroxy-5β-cholestanoic acid, 7β, 12α-dihydroxy-3-oxo-5β-cholestanoic acid, 3α, 7α, 12α, 24-tetrahydroxy-5β-cholestanoic acid, 3α, 7α, 12α, 26-tetrahydroxy-5β-cholestanoic acid, and 1β, 3α, 7α, 12α-tetrahydroxy-5β-cholestanoic acid were newly identified. And in addition to the C24, bile acids, such as chenodeoxycholic acid, ursodeoxycholic acid, cholic acid, and allocholic acid, identified previously, deoxycholic acid, 3α, 7α-dihydroxy-5β-chol-22-enoic acid, 3α, 7α, 12α-trihydroxy-5α-chol-22-enoic acid, and 3α, 7α, 12α-trihydroxy-5β-chol-22-enoic acid were newly identified.
    Download PDF (629K)
  • Shinwa YAMADA, Kenji FUJIWARA, Yuji OKA, Naohiko MASAKI, Hiroshi OKA
    1987Volume 101Issue 6 Pages 1385-1389
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    A cell-surface modulator of DNA synthesis by cultured rat hepatocytes was studied in relation to the liver regeneration process. When rat hepatocytes isolated 24 h after partial hepatectomy were cultured, the first burst of DNA synthesis peaked at 5-8 h and declined until 24 h, followed by the second burst. Rat liver plasma membranes added 2 h after plating inhibited only the second burst, while in the case of the normal hepatocytes where the DNA synthesis began to increase after 5 h, this inhibition was observed at 16 h but not at 8 h. The inhibition did not differ when the membranes obtained from regenerating livers 12 h after partial hepatectomy were used. Epidermal growth factor binding to the cultured hepatocytes was not hindered by the membranes. These results suggest that the modulator inhibits hepatocyte proliferation at the early G1-phase of the cell cycle and that its action might be controlled by other factors in the process of liver regeneration.
    Download PDF (357K)
  • Isamu YAMAMOTO, Atsuko ABE, Makoto ISHIMOTO
    1987Volume 101Issue 6 Pages 1391-1397
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    The dual pyridine nucleotide-specific glutamate dehydrogenase [EC 1. 4. 1. 3] was purified 37-fold from Bacteroides fragilis by ammonium sulfate fractionation, DEAE-Sephadex A-25 chromatography twice, and gel filtration on Sephacryl S-300. The enzyme had a molecular weight of approximately 300, 000, and polymeric forms (molecular weights of 590, 000 and 920, 000) were observed in small amounts on polyacrylamide gel disc electrophoresis. The molecular weight of the subunit was 48, 000. The isoelectric point of the enzyme was pH 5.1. This glutamate dehydrogenase utilized NAD (P) H and NAD (P)+ as coenzymes and showed maximal activities at pH 8.0 and 7.4 for the amination with NADPH and with NADH, respectively, and at pH 9.5 and 9.0 for the deamination with NADP+ and NAD+, respectively. The amination activity with NADPH was about 5-fold higher than that with NADH. The Lineweaver-Burk plot for ammonia showed two straight lines in the NADPH-dependent reactions. The values of Km for substrates were: 1.7 and 5.1mM for ammonium chloride, 0.14mM for 2-oxoglutarate, 0.013mM for NADPH, 2.4mM for L-glutamate, and 0.019mM for NADP+ in NADP-linked reactions, and 4.9mM for ammonium chloride, 7.1mM for 2-oxoglutarate, 0.2mM for NADH, 7.3mM for L-glutamate, and 3.0 mM for NAD+ in NAD-linked reactions. 2-Oxoglutarate and L-glutamate caused substrate inhibition in the NADPH and NADP+-dependent reactions, respectively, to some extent. NAD+- and NADH dependent activities were inhibited by 50% by 0.1M NaCl. Adenine nucleotides and dicarboxylic acids did not show remarkable effects on the enzyme activities.
    Download PDF (1252K)
  • Yoko OHGA, Mamoru NAKANISHI, Masamichi TSUBOI, Yukishige KAWASAKI
    1987Volume 101Issue 6 Pages 1399-1405
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    A group of initial processes in platelet activation, consisting of a platelet shape change, an intracellular calcium mobilization, a calcium efflux, and a membrane fluidity (mobility) change, has been examined in rabbit platelets by a multidimensional stopped-flow method with light scattering, light transmission, and fluorescence measurements. It was found that a 90° light scattering change and internal calcium release (monitored in terms of chlortetracycline fluorescence) take place after a short lag (5 s at 25°C and 2 s at 37°C) following activation by thrombin. The duration of the lag was the same in both cases. During the initial lag period, a rapid increase in platelet membrane fluidity (mobility) was observed by the use of pyrene excimer fluorescence. These results suggest that the intracellular calcium mobilization and the shape change are triggered by the same rate-determining step, and increase in membrane mobility may play some role in the initial stage of platelet activation before intracellular calcium mobilization occurs.
    Download PDF (543K)
  • Hiroyuki IWAMOTO, Takashi KOBAYASHI, Eiichi HASEGAWA, Yuhei MORITA
    1987Volume 101Issue 6 Pages 1407-1412
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    The instability of human myeloperoxidase [EC 1. 11. 1. 7] compound I, which was spontaneously reduced to compound II, and the abnormal stoichiometry of the reaction of myeloperoxidase with H2O2 were investigated. As to the former, a pretreatment of myeloperoxidase with H2O2 did not stabilize compound I, and no difference in its stability was observed between native (α2β2) and hemi (αβ) myeloperoxidase. From these results, it was thought that the instability of compound was caused by neither the presence of endogenous donors nor the intramolecular reduction of compound I to compound II by the other heme in the native enzyme molecule. As for the latter, true catalase activity of myeloperoxidase was demonstrated by monitoring O2 evolution after the injection of H2O2 into the enzyme solution. Myeloperoxidase compound I reacted with H2O2 and returned to the ferric state with concomitant evolution of an O2 molecule. Accordingly, the abnormal stoichiometry of the reaction with H2O2 and a part of the instability of compound I can probably be ascribed to this true catalase activity.
    Download PDF (482K)
  • Masaaki KURODA, Keith R. PORTER
    1987Volume 101Issue 6 Pages 1413-1427
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Cytoskeletons with three-dimensional architecture were isolated from cultured normal rat kidney cells. The preparation procedure consisted of Triton-demembranization of suspended cells followed by differential and sucrose density gradient centrifugation. By using higher (0.5%) and lower (0.1%) Triton concentrations for demembranization, two kinds of isolated cytoskeletons (CSK), called H-CSK and L-CSK, respectively, were prepared. H-CSK and L-CSK displayed unique morphology and protein composition. Three classes of cytoskeletal filaments, microfilaments, intermediate filaments, and microtubules were shown to be major components in the electron microscopic images of the H-CSK. Stereoscopic electron microscopy of the H-CSK, dried by the critical point method, revealed that the cytoskeletal filaments are arranged in three-dimensional configurations even after isolation in vitro. Two-dimensional gel electrophoresis demonstrated that the HCSK was composed mainly of actin, tubulin, and vimentin, reflecting its basic architecture. Electron microscopic images of L-CSK were more intricate than images of the H-CSK and showed, in addition to the filament types discussed above, anastomosing networks of short filamentous structures. These short filaments, with diameters of 3-8 nm and lengths of 30-150 nm, seemed to cross-link other elements of the cytoskeleton. The morphology of these short filaments resembles that of microtrabeculae observed in situ. Two-dimensional gels of the L-CSK showed over 100 protein spots when the gels were stained by the silver method. Subsequent treatment of the L-CSK with 0.5% Triton removed the microtrabeculae-like materials leaving as a residue the basic cytoskeleton similar to the H-CSK. Our observations indicate that microtrabeculae are composed of heterogenous proteins associated, in some instances, with a core structure of actin.
    Download PDF (5862K)
  • Masakazu ASO, Kohji MIYAZAKI, Jiro YANAGISAWA, Fumio NAKAYAMA
    1987Volume 101Issue 6 Pages 1429-1436
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Bile acid contents in isolated rat hepatocytes were determined by gas-liquid chromatography-mass spectrometry-selected ion monitoring with the use of deuteriumlabeled internal standards. This allowed us first to monitor the actual amounts of not only major but also minor bile acid components present with sufficient sensitivity and specificity and to follow the changes of individual bile acids in cultured rat hepatocytes simultaneously. In freshly isolated rat hepatocytes, cholic and β-muricholic acids were the major components, comprising 35 and 46% of the total bile acids, respectively. These two bile acids were found to be most actively synthesized during the first 2 h of incubation and continued to increase thereafter for up to 6 h (the end of the period studied). In contrast, chenodeoxycholic and α-muricholic acids, which are the precursors of β-muricholic acid, showed slight increases only in the first hour of incubation and decreased thereafter. These results suggested that the conversion to β-muricholic acid from chenodeoxycholic acid via α-muricholic acid occurred rapidly in cultured rat hepatocytes. The secondary bile acids such as deoxycholic, hyodeoxycholic, and 3α, 12β-dihydroxy-5β-cholanoic acids declined steadily from the start of incubation, which supported the findings that further hydroxylation of these dihydroxy bile acids occurs in rat liver.
    Download PDF (584K)
  • Masakuni DEGAWA, Hiroshi YAMADA, Takanori HISHINUMA, Takashi MASUKO, Y ...
    1987Volume 101Issue 6 Pages 1437-1445
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Male Sprague Dawley rats were injected intraperitoneally with 2-methoxy-4-aminoazobenzene (2-MeO-AAB) or 3-methylcholanthrene (MC), and then the expression of microsomal cytochrome P-450 isozymes in liver and extrahepatic tissues was investigated by means of immunological methods and a bacterial mutation test. The results of protein A-enzyme-linked immunosorbent assaying and immunoblotting using anti-rat cytochrome P-448 monoclonal antibodies showed that MC induced at least two microsomal cytochrome P-448 isozymes, a high spin form (cytochrome P-448 H) and a low spin form (cytochrome P-448 L), in liver, but that it induced only cytochrome P-448 L in extrahepatic tissues such as lung, kidney, small intestine, and colon. The results also indicated that, in contrast to MC, 2-MeO-AAB selectively induced microsomal cytochrome P-448 H in liver but did not induce any cytochrome P-448 isozymes in extrahepatic tissues. The activities of 9, 000 × g supernatants from the individual organs, as to the mutagenic conversion of 3 aromatic amines (3-amino-1-methyl-5H-pyrido (4, 3-b) indole, 2-amino-6-methyldipyrido (1, 2-a:3', 2'-d) -imidazole and 3-methoxy-4-aminoazobenzene), toward Salmonella typhimurium TA 98 bacteria were dependent upon the quantity and/or quality of the microsomal cytochrome P-448 isozymes in the organs.
    Download PDF (663K)
  • Toshifumi TSUKAHARA, Eiki KOMINAMI, Nobuhiko KATUNUMA
    1987Volume 101Issue 6 Pages 1447-1456
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Macrophage cell cultures were treated with menadione, zymosan, or phorbol myristate acetate (PMA), and changes in productions of superoxide anion and hydroperoxide, and in glutathione oxidation and S-thiolation of cystatin-β (formation of a mixed disulfide of cystatin-β and glutathione) were examined. All three compounds promoted production of superoxide anion and hydroperoxide, but only menadione caused extensive oxidation of glutathione. Menadione caused S-thiolation of cystatin-β in a dose-dependent fashion, but the other two compounds did not. Removal of menadione promptly reduced the oxidation of glutathione and S-thiolation of cystatin-β induced by menadione. Inhibition of catalase by aminotriazol caused slight increase in the GSSG content in both menadione- and zymosantreated cells, but not in S-thiolation of cystatin-β in zymosan-treated cells. None of the three compounds influenced appreciably the activity of glutathione peroxidase, glutathione reductase, or superoxide dismutase in cultured cells. These results indicate that S-thiolation of cystatin-β occurs in cells in response to oxidative challenge by menadione but not by zymosan or by the tumor promoter PMA. Dethiolation of cystatin-β by purified thiol transferase and protein disulfide isomerase in the presence of different concentrations of GSH was examined in vitro. Both enzymes catalyzed dethiolation of cystatin-β at a much lower level of GSH than that required for the non-enzymatic reaction, suggesting the importance of enzymatic catalysis of S-thiolation and dethiolation of cystatin-β in cells.
    Download PDF (3034K)
  • Toshiaki HIRATSUKA
    1987Volume 101Issue 6 Pages 1457-1462
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    7-Diethylamino-3- (4'-isothiocyanatophenyl) -4-methylcoumarin (CPI), rhodamine B isothiocyanate (RITC), and 4-bromomethyl-6, 7-dimethoxycoumarin (BDMC), fluorescent reagents that can react covalently with amino or sulfhydryl groups, have been used to label myosin subfragment-1 (S-1) ATPase. The conditions under which CPI, RITC, and BDMC selectively label the 50-, 26-, and 20-kDa segments of the S-1 heavy chain, respectively, are described. CPI and RITC labeling little affects the ATPase activities of S-1 in the presence and absence of actin. BDMC labeling activates the Ca2+- and Mg2+-ATPases of S-1, and abolishes the K+-EDTAATPase. The three S-1 derivatives fluoresce strongly even under acidic conditions, suggesting the wide applicability of these fluorescent reagents as selective labels for the three segments of the S-1 heavy chain.
    Download PDF (1223K)
  • Yoshiyuki HAKEDA, Yoshinori NAKATANI, Takahiko YOSHINO, Noriyoshi KURI ...
    1987Volume 101Issue 6 Pages 1463-1469
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    The effect of forskolin on collagen production in osteoblasts was investigated by using clonal osteoblastic MC3T3-E1 cells cultured in a-minimum essential medium containing 0.1% bovine serum albumin. Forskolin increased the adenylate cyclase activity in membranes pelleted from homogenates of the cell line in a dose-dependent manner. The drug caused a 13-fold stimulation at 10-4M, indicating that the compound directly acts on adenylate cyclase, leading to an increase in the intracellular cAMP content of the cells. Collagen accumulation in the cultures was elevated by one-day treatment with 5×10-5M forskolin to about twice that in the controls. The stimulation was mainly due to an elevation in collagen synthesis but not to an inhibition of intracellular collagen degradation because forskolin dose-dependently increased collagen synthesis; it also significantly increased the amount of low-molecular-weight hydroxyproline found in the cultures. Cells treated with forskolin produced mainly type I collagen, as found in bone matrix in situ, with only small amounts of other types of collagen. Furthermore, forskolin time-dependently inhibited DNA synthesis in the cells, indicating that the increase in type I collagen synthesis by forskolin was not due to stimulated cell proliferation. These results suggest that cAMP is closely linked to the differentiation of osteoblasts in vitro.
    Download PDF (594K)
  • Norio KAGAWA, Katsuyoshi MIHARA, Ryo SATO
    1987Volume 101Issue 6 Pages 1471-1479
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Two cDNA clones, pHPah1 and pHPah2, encoding polycyclic hydrocarbon-inducible forms of rabbit liver microsomal cytochrome P-450 were isolated and their nucleotide sequences were determined. The inserts of pHPahl and pHPah2 contained open reading frames specifying the entire primary structures of cytochrome P-450s, consisting of 518 and 516 amino acid residues, respectively. The deduced amino acid sequences for pHPahl and pHPah2 are 76 and 73% homologous with rat P-450c and P-450d, respectively, and 96% homologous with rabbit P-450 forms 6 and 4, respectively. We conclude that pHPah1 and pHPah2 encode the rabbit counterparts of rat P-450c and P-450d, respectively. A region highly conserved in all species of cytochrome P-450 so far examined, called the HR 2 region, can be detected in the pHPahl and pHPah2 primary structures, but another conserved region, HR1, cannot be observed. Northern hybridization analysis of total RNAs from livers of untreated and drug-treated rabbits demonstrated that the pHPah1 and pHPah2 genes are expressed in untreated animals, induced considerably by administration of βmethylcholanthrene or β-naphthoflavone, and suppressed by phenobarbital and isosafrole.
    Download PDF (2297K)
  • Masatake OOSAWA, Shin SHIMAOKA, Takashi FUNATSU, Shin'chi ISHIWATA, Ko ...
    1987Volume 101Issue 6 Pages 1481-1483
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    β-Actinin is an actin-pointed end capping protein in skeletal muscle. Casella et al. have reported that a protein isolated from muscle acetone powder by procedures similar to those used for β-actinin purification caps the barbed end of an actin filament (J. Biol. Chem. 261, 10915-10921 (1986)). We have confirmed the above results. However, it turned out that the two proteins were identical as to subunit sizes, peptide maps, and cross-reactivities with anti-β-actinin IgG. The binding of the two proteins to opposite ends of an actin filament remains unexplained.
    Download PDF (1604K)
  • Keita ARAKAWA, Tetsuko TAKABE, Tatsuo SUGIYAMA, Takashi AKAZAWA
    1987Volume 101Issue 6 Pages 1485-1488
    Published: 1987
    Released on J-STAGE: June 30, 2008
    JOURNAL FREE ACCESS
    Betaine-aldehyde dehydrogenase was purified from spinach leaves and characterized. The molecular weight of the enzyme was estimated to be 120 kDa by a gel filtration chromatography. The enzyme was judged to consist of two identical pieces of the monomeric subunit with molecular weight of 60 kDa. A specific polyclonal antibody was raised against the enzyme subunit.
    Download PDF (1028K)
feedback
Top